art blogTumblr (3.0; @jehanchoo)http://jehanchoo.tumblr.com/<img src="http://24.media.tumblr.com/2bf5f3cbac378908706d42ef20214753/tumblr_mn8374CpVC1rvrxhzo1_500.jpg"/><br/><br/><p>“Petit Lapin” by Jehan Choo</p>http://jehanchoo.tumblr.com/post/51104046425http://jehanchoo.tumblr.com/post/51104046425Wed, 22 May 2013 16:13:52 -0700littlerabbitpetitlapinbunnymaskchildkidchildrenyoungyouthart on tumblrartofthedaypaintingsketchplaidcuteillustrationjehan chooartmy artartworkartists on tumblrinnocencechiaroscuroradbucket<img src="http://25.media.tumblr.com/0939973f1554b0fdfa462d35a717dcbc/tumblr_mkpgirCK3Q1rvrxhzo1_500.jpg"/><br/><br/><p>Hunger</p> <p>Way back Wednesday! Old piece from The Hive Gallery’s 4th Anniversary show, 2009. My very first wall..<br/><span> </span></p>http://jehanchoo.tumblr.com/post/47066273609http://jehanchoo.tumblr.com/post/47066273609Wed, 03 Apr 2013 17:40:00 -0700waybackwednesdaygirlstwinsvampirehungersmirkfurhatsbearredeyesradbucket<img src="http://24.media.tumblr.com/77c0211ad9a1c03bcf9bb2d70212e042/tumblr_mk0y9l90KF1rvrxhzo1_500.jpg"/><br/><br/><p>The Caterpillar</p> <p><span>—</span></p> <p>“What size do you want to be?” it asked.</p> <p><span>“Oh, I’m not particular as to size,” Alice hastily replied; “only one doesn’t like changing so often, you know.”</span></p>http://jehanchoo.tumblr.com/post/45927301849http://jehanchoo.tumblr.com/post/45927301849Thu, 21 Mar 2013 12:03:00 -0700caterpillarAlice In WonderlandalicemushroompsychedelicdotsLewis Carrollhookahillustrationpaintingdrawingradbucket<img src="http://25.media.tumblr.com/daf0068cfc4f17d22f96e21f2141505f/tumblr_mk0xx8U4Mi1rvrxhzo1_500.jpg"/><br/><br/><p>The Red Queen</p>http://jehanchoo.tumblr.com/post/45926837891http://jehanchoo.tumblr.com/post/45926837891Thu, 21 Mar 2013 11:55:56 -0700aliceAlice In WonderlandLewis CarrollIllustrationwhite rabbitheartsking of heartsqueen of heartsradbucket<img src="http://24.media.tumblr.com/5d8129f921d254737494ed8e709945b7/tumblr_milh2xmeUe1rvrxhzo1_500.jpg"/><br/><br/><p>Alice</p>http://jehanchoo.tumblr.com/post/43679387204http://jehanchoo.tumblr.com/post/43679387204Thu, 21 Feb 2013 15:54:33 -0800aliceAlice In WonderlandartLewis CarrollIllustrationblue dresslooking glassradbucket<img src="http://25.media.tumblr.com/ea3812cdea4bd7f3bfe88dfd31be118a/tumblr_mhrtjcStnW1rvrxhzo1_500.jpg"/><br/><br/><p><span>Hello friends!</span><br/><br/><span>My friend Alex is a writer, editor and entrepreneur, and I love drawing.  We thought we’d join forces for a little experiment in e-publishing.</span><br/><br/><span>We decided to take Lewis Carroll’s classic </span><span class="il">Alice</span><span>’s Adventures in Wonderland (a public domain book) and illustrate it with 16 original paintings.</span><br/><br/><span>After a lot of work, we’re finally ready to share!  Our “imprint” is called Standard Ebooks, and we’re releasing this DRM-free ebook optimized for lots of different ereaders including iPad, Kindle, Nook, and more.  If you don’t have an ereader, you can also read it with the Kindle or Nook software on your desktop computer.</span><br/><br/><span>Check it out at </span><a href="https://standardebooks.com/" target="_blank"><a href="https://standardebooks.com">https://standardebooks.com</a></a><span>.</span><br/><br/><span>Our next project is going to be a collection of Grimm’s fairy tales illustrated with 39 different pieces by 14 different indie artists. We’ve already got the art in -</span><span>- it’s going to be great!</span></p>http://jehanchoo.tumblr.com/post/42386019409http://jehanchoo.tumblr.com/post/42386019409Tue, 05 Feb 2013 15:35:36 -0800ebooksstandardebooksartdownloaddigitaljehan chooalicealice in wonderlandcaterpillarillustrationlewis carrollradbucket<img src="http://24.media.tumblr.com/203e93cdbfd61b143d6801fa7945ab07/tumblr_mhh05eQpE91rvrxhzo1_500.jpg"/><br/><br/><p>Bunny Girl</p>http://jehanchoo.tumblr.com/post/41918548204http://jehanchoo.tumblr.com/post/41918548204Wed, 30 Jan 2013 19:24:00 -0800bunnygirlhipstermaskshortsnudepencildrawingdarkjehan chooradbucket<img src="http://24.media.tumblr.com/ceea2b1e65046779018575944c45cb71/tumblr_mgznp2hrdP1rvrxhzo1_500.jpg"/><br/><br/><p>The River Nymph</p>http://jehanchoo.tumblr.com/post/41119816361http://jehanchoo.tumblr.com/post/41119816361Mon, 21 Jan 2013 10:36:38 -0800nymphnaiadpotamidepotamidesnymphsnaiadsartpaintingillustrationjehan chooriverrocksstreamhidingwhite hairblue eyespreyalertnudewaterfragileao nymphradbucket<img src="http://25.media.tumblr.com/3a5eccacd86f10bb6df21ca2a757093f/tumblr_mg9zv9Ab7y1rvrxhzo1_500.jpg"/><br/><br/><p><span>The Giving Tree<br/><br/>“… I have nothing left to give you.  My apples are gone.” - </span><span>Shel Silverstein</span></p> <p><span><br/></span></p>http://jehanchoo.tumblr.com/post/39956279179http://jehanchoo.tumblr.com/post/39956279179Mon, 07 Jan 2013 14:01:57 -0800Shel SilversteinThe Giving TreeJehan ChooArtIllustrationInterpretationtreestumpapplesi have nothingpaintingalternatecutaxnaturetakeradbucket<img src="http://25.media.tumblr.com/tumblr_mdfabsTMJp1rvrxhzo1_500.jpg"/><br/><br/><p>Signed, archival print of “Alas I Cannot Swim” now available!</p> <p>Giclee print on Fine Art Hahnemuhle Photo Rag Matte paper.</p> <p>16” x 11.5”</p> <p><u><a href="http://jehanchoo.bigcartel.com/product/alas-i-cannot-swim" target="_blank">Order safely through Big Cartel</a></u></p> <div></div>http://jehanchoo.tumblr.com/post/35630134107http://jehanchoo.tumblr.com/post/35630134107Tue, 13 Nov 2012 02:55:00 -0800jehan chooalas i cannot swimlaura marlingprintgicleebuyposterpurchaseradbucket<img src="http://24.media.tumblr.com/tumblr_mcpt6o0Yw21rvrxhzo1_r2_500.jpg"/><br/><br/><p>Hey Lolita</p>http://jehanchoo.tumblr.com/post/34641150964http://jehanchoo.tumblr.com/post/34641150964Tue, 30 Oct 2012 09:44:00 -0700lolitapaintingjehan chooheart sunglassesradbucket<p align="center"><img height="350" src="http://www.jehanchoo.com/images/lauren_oconnell_jehan_choo.jpg" width="350"/></p> <p>This piece is now the cover for <a href="http://laurenoconnell.bandcamp.com/album/covers">Lauren O&#8217;Connell</a>&#8217;s latest album! She has always been a big inspiration of mine.  The album is simply beautiful. <a href="http://laurenoconnell.bandcamp.com/album/covers" target="_blank">Listen here</a>!</p> <p><iframe frameborder="0" height="315" src="http://www.youtube.com/embed/lGf8r9txI3w?rel=0" width="560"></iframe></p>http://jehanchoo.tumblr.com/post/34548968491http://jehanchoo.tumblr.com/post/34548968491Sun, 28 Oct 2012 22:34:00 -0700lauren o'connercoversalbumpaintingjehan chooradbucket<img src="http://25.media.tumblr.com/tumblr_m9uon0u4BC1rvrxhzo1_500.jpg"/><br/><br/><p>Off to the Races</p>http://jehanchoo.tumblr.com/post/30901171089http://jehanchoo.tumblr.com/post/30901171089Tue, 04 Sep 2012 17:13:00 -0700carouselhorseslana del reyoff to the racespaintingjehan chooradbucket<img src="http://24.media.tumblr.com/tumblr_m8g3me0AKi1rvrxhzo1_500.jpg"/><br/><br/><p>I Feel Like I Know Her, But Sometimes My Arms Bend Back.</p>http://jehanchoo.tumblr.com/post/28987167303http://jehanchoo.tumblr.com/post/28987167303Wed, 08 Aug 2012 09:39:00 -0700david lynchtwin peaksarrowbull terrierpink chairbunny maskpaintingjehan chooradbucket<img src="http://25.media.tumblr.com/tumblr_m5wjk5515H1rvrxhzo1_500.jpg"/><br/><br/><p>Constellations</p>http://jehanchoo.tumblr.com/post/25490270982http://jehanchoo.tumblr.com/post/25490270982Tue, 19 Jun 2012 23:04:00 -0700constellationsstarsjehan choopaintingradbucket<img src="http://25.media.tumblr.com/tumblr_m3j41jsBu41rvrxhzo1_r1_500.jpg"/><br/><br/><p>Alas I Cannot Swim</p> <p>—</p> <p>“There is gold across the river</p> <p>but I don’t want none.</p> <p>Gold is fleeting,</p> <p>gold is fickle, gold is fun”</p> <p>- Laura Marling</p>http://jehanchoo.tumblr.com/post/22422766405http://jehanchoo.tumblr.com/post/22422766405Fri, 04 May 2012 19:53:00 -0700laura marlingpaintingalas i cannot swimbunny maskgolden gunjehan choogoldradbucket<img src="http://25.media.tumblr.com/tumblr_m3hn1pTQyJ1rvrxhzo1_500.jpg"/><br/><br/><p>Stay Gold Pony Boy</p>http://jehanchoo.tumblr.com/post/22374094227http://jehanchoo.tumblr.com/post/22374094227Fri, 04 May 2012 00:49:00 -0700goldgoldenboyponyboythe outsidersjehan choopaintingradbucket<img src="http://24.media.tumblr.com/tumblr_m3hmem0LHR1rvrxhzo1_500.jpg"/><br/><br/><p>Tooth Faerie</p>http://jehanchoo.tumblr.com/post/22373825500http://jehanchoo.tumblr.com/post/22373825500Fri, 04 May 2012 00:35:00 -0700faerietooth fairypaintingjehan chooradbucket<img src="http://25.media.tumblr.com/tumblr_m3hm71A4VS1rvrxhzo1_500.jpg"/><br/><br/><p>Atom Boy</p>http://jehanchoo.tumblr.com/post/22373734506http://jehanchoo.tumblr.com/post/22373734506Fri, 04 May 2012 00:30:37 -0700atomboyjehanchooillustrationradbucket